Atlas Antibodies Anti-MAST1 Antibody

상품 한눈에 보기

Human MAST1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 단백질 발현 분석에 적합. RNA-seq 데이터 기반 Orthogonal 검증 완료. PrEST 항원을 이용한 친화정제 방식으로 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA073106-100 Anti-MAST1 Antibody, microtubule associated serine/threonine kinase 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA073106-25 Anti-MAST1 Antibody, microtubule associated serine/threonine kinase 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: microtubule associated serine/threonine kinase 1 (MAST1)
Type: Polyclonal Antibody against Human MAST1

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

KIAA0973, SAST

항목	내용
Target Protein	microtubule associated serine/threonine kinase 1
Target Gene	MAST1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	LTLREKTWRGGSPEIKRFSASEASFLEGEASPPLGARRRFSALLEPSRFSAPQEDEDE
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000003469 (98%), Mouse ENSMUSG00000053693 (98%)