
Atlas Antibodies Anti-MAP3K1 Antibody
상품 한눈에 보기
인간 MAP3K1 단백질을 인식하는 토끼 폴리클로날 항체. 면역형광(ICC) 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며 마우스, 랫과 높은 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAP3K1 Antibody
mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase
Recommended Applications
면역형광(ICC) 등 다양한 면역학적 분석에 사용 가능.
Product Description
Polyclonal Antibody against Human MAP3K1
Alternative Gene Names
MAPKKK1, MEKK, MEKK1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | mitogen-activated protein kinase kinase kinase 1, E3 ubiquitin protein ligase |
| Target Gene | MAP3K1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | SSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSDTTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQDALPIVPQLQVENGEDIIIIQQ |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000021754 | 94% |
| Rat | ENSRNOG00000050275 | 91% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAP3K13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP3K13 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP3K1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2K7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP3K10 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.