CacheBy
Atlas Antibodies Anti-MAP3K13 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAP3K13 Antibody

상품 한눈에 보기

Human MAP3K13 단백질을 인식하는 고특이성 Rabbit Polyclonal 항체. IHC, WB, ICC 등 다양한 응용 가능. PrEST 항원을 이용한 친화 정제 방식으로 높은 재현성과 신뢰성 제공. Human에 검증된 반응성.

카탈로그번호
HPA036692-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036692-100 Anti-MAP3K13 Antibody, mitogen-activated protein kinase kinase kinase 13 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036692-25 Anti-MAP3K13 Antibody, mitogen-activated protein kinase kinase kinase 13 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAP3K13 Antibody

Anti-MAP3K13 Antibody

Target Information

  • Target Protein: Mitogen-activated protein kinase kinase kinase 13
  • Target Gene: MAP3K13
  • Alternative Gene Names: LZK, MEKK13
  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MAP3K13.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

KKYPGTYKRHPVRPIIHPNAMEKLMKRKGVPHKSGMQTKRPDLLRSEGIPTTEVAPTASPLSGSPKMSTSSSKSRYRSKPRHRRGNSRGSHSDFAAILKNQPAQENSPHPTYLHQAQSQYPSLHHHNSLQQQYQQP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000033618 87%
Rat ENSRNOG00000025423 83%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.