
Atlas Antibodies Anti-MAP2K4 Antibody
상품 한눈에 보기
Human MAP2K4 단백질을 인식하는 Rabbit Polyclonal 항체. WB 및 ICC 응용에 적합. PrEST 항원으로 친화 정제됨. 높은 종 간 교차 반응성(마우스 97%, 랫 88%). 40% glycerol/PBS buffer에 보존제 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAP2K4 Antibody
Target: Mitogen-activated protein kinase kinase 4 (MAP2K4)
Supplier: Atlas Antibodies
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human MAP2K4.
Alternative Gene Names
JNKK1, MEK4, MKK4, PRKMK4, SERK1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Mitogen-activated protein kinase kinase 4 |
| Target Gene | MAP2K4 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000033352 (97%), Rat ENSRNOG00000003834 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Notes | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Antigen Sequence
PAVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI
Safety Information
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAP2K5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2K4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2K1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.