
Atlas Antibodies Anti-MAP2K1 Antibody
상품 한눈에 보기
Human MAP2K1 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC에 적합합니다. MEK1/MAPKK1/PRKMK1 대체 유전자명으로 알려진 표적을 검출하며, PrEST 항원을 이용해 친화 정제되었습니다. 고순도 PBS 버퍼 및 sodium azide 보존제를 포함합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAP2K1 Antibody
Target: Mitogen-activated protein kinase kinase 1 (MAP2K1)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human MAP2K1.
Alternative Gene Names
MAPKK1, MEK1, PRKMK1
Target Information
- Target Protein: Mitogen-activated protein kinase kinase 1
- Target Gene: MAP2K1
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000004936 | 100% |
| Rat | ENSRNOG00000010176 | 53% |
Antibody Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAP2K4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2K1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP2K2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAP1LC3A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.