CacheBy
Atlas Antibodies Anti-MAP2K1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAP2K1 Antibody

상품 한눈에 보기

Human MAP2K1 단백질을 인식하는 Rabbit Polyclonal Antibody로, IHC, WB, ICC에 적합합니다. MEK1/MAPKK1/PRKMK1 대체 유전자명으로 알려진 표적을 검출하며, PrEST 항원을 이용해 친화 정제되었습니다. 고순도 PBS 버퍼 및 sodium azide 보존제를 포함합니다.

카탈로그번호
HPA026430-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026430-100 Anti-MAP2K1 Antibody, mitogen-activated protein kinase kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026430-25 Anti-MAP2K1 Antibody, mitogen-activated protein kinase kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAP2K1 Antibody

Anti-MAP2K1 Antibody

Target: Mitogen-activated protein kinase kinase 1 (MAP2K1)

  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human MAP2K1.

Alternative Gene Names

MAPKK1, MEK1, PRKMK1

Open Datasheet

Target Information

  • Target Protein: Mitogen-activated protein kinase kinase 1
  • Target Gene: MAP2K1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    MPKKKPTPIQLNPAPDGSAVNGTSSAETNLEALQKKLEELELDEQQRKRLEAFLTQKQ

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000004936 100%
Rat ENSRNOG00000010176 53%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.