
Atlas Antibodies Anti-MAGI1 Antibody
Human MAGI1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제조됨. Affinity purification으로 높은 특이성과 신뢰성 확보. ICC 등 다양한 응용에 적합하며, Human에 검증된 반응성. 안정한 PBS 버퍼와 glycerol 기반 보존액 포함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAGI1 Antibody
Target: membrane associated guanylate kinase, WW and PDZ domain containing 1
Type: Polyclonal Antibody against Human MAGI1
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody specifically targeting the human MAGI1 protein.
Alternative Gene Names
AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | membrane associated guanylate kinase, WW and PDZ domain containing 1 |
| Target Gene | MAGI1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000045095 (93%), Rat ENSRNOG00000022060 (92%) |
Antigen Sequence:
IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-MAGIX Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGOH Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGI1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGI1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-MAGEH1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|