
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-MAGI1 Antibody
상품 한눈에 보기
Human MAGI1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제조됨. Affinity purification으로 높은 특이성과 신뢰성 확보. ICC 등 다양한 응용에 적합하며, Human에 검증된 반응성. 안정한 PBS 버퍼와 glycerol 기반 보존액 포함.
- 카탈로그번호
- HPA077002-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA077002-100 Anti-MAGI1 Antibody, membrane associated guanylate kinase, WW and PDZ domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077002-25 Anti-MAGI1 Antibody, membrane associated guanylate kinase, WW and PDZ domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-MAGI1 Antibody
Anti-MAGI1 Antibody
Target: membrane associated guanylate kinase, WW and PDZ domain containing 1
Type: Polyclonal Antibody against Human MAGI1
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody specifically targeting the human MAGI1 protein.
Alternative Gene Names
AIP3, BAIAP1, BAP1, MAGI-1, TNRC19, WWP3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | membrane associated guanylate kinase, WW and PDZ domain containing 1 |
| Target Gene | MAGI1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000045095 (93%), Rat ENSRNOG00000022060 (92%) |
Antigen Sequence:
IVEVNKKNVQALTHNQVVDMLVECPKGSEVTLLVQRGGLPVPKKSPKSQPLERKDSQNSSQHSVSSHRSLHTASPSHSTQVLPEFPPAEAQAPDQTD
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



