CacheBy
Atlas Antibodies Anti-MAGOH Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-MAGOH Antibody

상품 한눈에 보기

인간 MAGOH 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC 및 WB에 적합하며, PrEST 항원으로 친화 정제됨. 인간, 마우스, 랫트에 모두 반응성이 확인됨. 안정적인 PBS/glycerol 버퍼에 보존됨.

카탈로그번호
HPA043036-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043036-100 Anti-MAGOH Antibody, mago homolog, exon junction complex core component 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043036-25 Anti-MAGOH Antibody, mago homolog, exon junction complex core component 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-MAGOH Antibody

Anti-MAGOH Antibody

Target: mago homolog, exon junction complex core component
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human MAGOH.

Alternative Gene Names

MAGOH1, MAGOHA

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein mago homolog, exon junction complex core component
Target Gene MAGOH
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000030188 (100%), Rat ENSRNOG00000010316 (100%)

Antigen Sequence:

KLRYANNSNYKNDVMIRKEAYVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHIS

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.