Atlas Antibodies Anti-MAGEB2 Antibody
상품 한눈에 보기
인간 MAGEB2 단백질을 인식하는 폴리클로날 항체입니다. 멜라노마 항원 패밀리 연구에 적합하며, 토끼 유래 IgG 형식입니다. 고순도 친화 정제 제품으로 인체 반응성이 검증되었습니다. 다양한 면역학적 응용에 사용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-MAGEB2 Antibody
Target: Melanoma antigen family B2
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human MAGEB2 protein.
Alternative Gene Names
CT3.2, DAM6, MAGE-XP-2, MGC26438
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Melanoma antigen family B2 |
| Target Gene | MAGEB2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000073069 (43%), Rat ENSRNOG00000055102 (40%) |
Antigen Sequence:
EGLSVVFGLELNKVNPNGHTYTFIDKVDLTDEESLLSSWDFP
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Recommended Applications
면역세포화학(ICC) 등 다양한 면역학적 분석에 사용 가능.
Notes
- 사용 전 부드럽게 혼합하십시오.
- 최적 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-MAGED4B Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAGEE2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAGEB2 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAGEB3 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-MAGEB5 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.