CacheBy
Thermo Fisher Scientific EWSR1 Polyclonal Antibody
원본

Thermo Fisher Scientific EWSR1 Polyclonal Antibody

상품 한눈에 보기

EWSR1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. 인간, 마우스, 랫트 반응성. WB, IHC, ICC, Flow 등 다양한 응용 가능. 항원 친화 크로마토그래피로 정제된 고품질 연구용 항체.

카탈로그번호
PA579225
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 02:31
Thermo Fisher Scientific PA579225 EWSR1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific EWSR1 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Immunohistochemistry (Frozen) (IHC (F)) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 2 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369–399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions −20 °C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2746341

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

This gene encodes a multifunctional protein involved in gene expression, cell signaling, and RNA processing and transport.
The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain.
Chromosomal translocations between this gene and various transcription factor genes produce chimeric proteins implicated in tumorigenesis, including Ewing sarcoma and related tumors.
Alternative splicing results in multiple transcript variants, and related pseudogenes exist on chromosomes 1 and 14.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 정보 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.