Thermo Fisher Scientific EWSR1 Polyclonal Antibody
EWSR1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. 인간, 마우스, 랫트 반응성. WB, IHC, ICC, Flow 등 다양한 응용 가능. 항원 친화 크로마토그래피로 정제된 고품질 연구용 항체.
- 카탈로그번호
- PA579225
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific EWSR1 Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369–399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20 °C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746341 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a multifunctional protein involved in gene expression, cell signaling, and RNA processing and transport.
The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain.
Chromosomal translocations between this gene and various transcription factor genes produce chimeric proteins implicated in tumorigenesis, including Ewing sarcoma and related tumors.
Alternative splicing results in multiple transcript variants, and related pseudogenes exist on chromosomes 1 and 14.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 정보 없음)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.