Thermo Fisher Scientific EWSR1 Polyclonal Antibody
EWSR1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. 인간, 마우스, 랫트 반응성. WB, IHC, ICC, Flow 등 다양한 응용 가능. 항원 친화 크로마토그래피로 정제된 고품질 연구용 항체.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369–399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | −20 °C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746341 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene encodes a multifunctional protein involved in gene expression, cell signaling, and RNA processing and transport.
The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain.
Chromosomal translocations between this gene and various transcription factor genes produce chimeric proteins implicated in tumorigenesis, including Ewing sarcoma and related tumors.
Alternative splicing results in multiple transcript variants, and related pseudogenes exist on chromosomes 1 and 14.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 정보 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific FABP2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Factor VIII Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific EWSR1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Prothrombin Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CD142 Polyclonal Antibody
544,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|