Thermo Fisher Scientific CCT3 Polyclonal Antibody
CCT3 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot, IHC, ICC, Flow cytometry 등 다양한 응용에 적합. 항원 친화 크로마토그래피로 정제되었으며, 동결 건조 형태로 제공. 연구용으로만 사용 가능.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CCT3 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL | - |
| Immunocytochemistry (ICC/IF) | 2 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human CCT3 (497–536 aa: EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746069 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The CCT3 protein is a molecular chaperone and a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two stacked rings, each containing eight distinct subunits. It assists in the ATP-dependent folding of unfolded polypeptides, including actin and tubulin. Multiple splice variants and a pseudogene on chromosome 8 have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.