Thermo Fisher Scientific CCT3 Polyclonal Antibody
CCT3 단백질을 인식하는 Thermo Fisher Scientific의 rabbit polyclonal antibody. Western blot, IHC, ICC, Flow cytometry 등 다양한 응용에 적합. 항원 친화 크로마토그래피로 정제되었으며, 동결 건조 형태로 제공. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilutions
| Application | Tested Dilution | Publications |
|---|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL | View 1 publication |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL | - |
| Immunohistochemistry (Frozen) (IHC (F)) | 0.5–1 µg/mL | - |
| Immunocytochemistry (ICC/IF) | 2 µg/mL | - |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells | - |
Product Specifications
| Item | Description |
|---|---|
| Species Reactivity | Human, Rat |
| Published Species | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to the C-terminus of human CCT3 (497–536 aa: EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746069 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The CCT3 protein is a molecular chaperone and a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two stacked rings, each containing eight distinct subunits. It assists in the ATP-dependent folding of unfolded polypeptides, including actin and tubulin. Multiple splice variants and a pseudogene on chromosome 8 have been identified.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CCR5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific TCP-1 beta Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CCT3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CCR5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CCS Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|