CacheBy
Thermo Fisher Scientific CCS Polyclonal Antibody
원본

Thermo Fisher Scientific CCS Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 CCS Polyclonal Antibody는 인간, 마우스, 랫트에서 반응하며 Western blot 및 IHC(P) 실험에 적합합니다. 항원 친화 크로마토그래피로 정제된 비결합 항체로, Cu/Zn superoxide dismutase 활성화 연구에 활용됩니다. 연구용 전용 제품입니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오전 07:52
Thermo Fisher Scientific PA578951 CCS Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific CCS Polyclonal Antibody

Applications

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174–209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage conditions −20°C
Shipping conditions Wet ice
RRID AB_2746067

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Superoxide dismutase (SOD) is an antioxidant enzyme involved in the defense system against reactive oxygen species (ROS).
SOD catalyzes the dismutation of superoxide radical anion (O₂⁻) to hydrogen peroxide, which is further converted to O₂ and H₂O by glutathione peroxidase and catalase.

Several classes of SOD have been identified:

  • Cu, Zn-SOD (SOD1): intracellular, 32 kDa homodimeric enzyme
  • Mn-SOD (SOD2): mitochondrial matrix enzyme, 80 kDa tetrameric form
  • EC-SOD (SOD3): extracellular, heparin-binding multimer
  • CCS (SOD4): copper chaperone for superoxide dismutase that delivers Cu to Cu/Zn-SOD

CCS may activate Cu/Zn-SOD through direct insertion of the Cu cofactor.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.