Thermo Fisher Scientific CCS Polyclonal Antibody
Thermo Fisher Scientific의 CCS Polyclonal Antibody는 인간, 마우스, 랫트에서 반응하며 Western blot 및 IHC(P) 실험에 적합합니다. 항원 친화 크로마토그래피로 정제된 비결합 항체로, Cu/Zn superoxide dismutase 활성화 연구에 활용됩니다. 연구용 전용 제품입니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific CCS Polyclonal Antibody
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174–209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746067 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Superoxide dismutase (SOD) is an antioxidant enzyme involved in the defense system against reactive oxygen species (ROS).
SOD catalyzes the dismutation of superoxide radical anion (O₂⁻) to hydrogen peroxide, which is further converted to O₂ and H₂O by glutathione peroxidase and catalase.
Several classes of SOD have been identified:
- Cu, Zn-SOD (SOD1): intracellular, 32 kDa homodimeric enzyme
- Mn-SOD (SOD2): mitochondrial matrix enzyme, 80 kDa tetrameric form
- EC-SOD (SOD3): extracellular, heparin-binding multimer
- CCS (SOD4): copper chaperone for superoxide dismutase that delivers Cu to Cu/Zn-SOD
CCS may activate Cu/Zn-SOD through direct insertion of the Cu cofactor.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.