Thermo Fisher Scientific CCS Polyclonal Antibody
Thermo Fisher Scientific의 CCS Polyclonal Antibody는 인간, 마우스, 랫트에서 반응하며 Western blot 및 IHC(P) 실험에 적합합니다. 항원 친화 크로마토그래피로 정제된 비결합 항체로, Cu/Zn superoxide dismutase 활성화 연구에 활용됩니다. 연구용 전용 제품입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence at the C-terminus of human CCS (174–209aa DADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | −20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746067 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Superoxide dismutase (SOD) is an antioxidant enzyme involved in the defense system against reactive oxygen species (ROS).
SOD catalyzes the dismutation of superoxide radical anion (O₂⁻) to hydrogen peroxide, which is further converted to O₂ and H₂O by glutathione peroxidase and catalase.
Several classes of SOD have been identified:
- Cu, Zn-SOD (SOD1): intracellular, 32 kDa homodimeric enzyme
- Mn-SOD (SOD2): mitochondrial matrix enzyme, 80 kDa tetrameric form
- EC-SOD (SOD3): extracellular, heparin-binding multimer
- CCS (SOD4): copper chaperone for superoxide dismutase that delivers Cu to Cu/Zn-SOD
CCS may activate Cu/Zn-SOD through direct insertion of the Cu cofactor.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific CCT3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CCR5 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CCS Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CP110 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific CCR1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|