
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ANAPC1 Antibody
상품 한눈에 보기
인간 ANAPC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 추천됩니다. Rabbit 유래 IgG 형태이며, PrEST 항원으로 정제되었습니다. 인간에 반응하며 rat, mouse와 99% 서열 동일성을 보입니다.
- 카탈로그번호
- HPA042998-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA042998-100 Anti-ANAPC1 Antibody, anaphase promoting complex subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042998-25 Anti-ANAPC1 Antibody, anaphase promoting complex subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ANAPC1 Antibody
Anti-ANAPC1 Antibody
Target: Anaphase Promoting Complex Subunit 1 (ANAPC1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human ANAPC1.
Alternative Gene Names
APC1, MCPR, TSG24
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Anaphase Promoting Complex Subunit 1 |
| Target Gene | ANAPC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016965 (99%), Mouse ENSMUSG00000014355 (99%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
PPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGH제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



