
Atlas Antibodies Anti-ANAPC1 Antibody
상품 한눈에 보기
인간 ANAPC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 추천됩니다. Rabbit 유래 IgG 형태이며, PrEST 항원으로 정제되었습니다. 인간에 반응하며 rat, mouse와 99% 서열 동일성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ANAPC1 Antibody
Target: Anaphase Promoting Complex Subunit 1 (ANAPC1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human ANAPC1.
Alternative Gene Names
APC1, MCPR, TSG24
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Anaphase Promoting Complex Subunit 1 |
| Target Gene | ANAPC1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000016965 (99%), Mouse ENSMUSG00000014355 (99%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
PPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGH제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ANAPC11 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANAPC10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANAPC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANAPC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ANAPC1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.