CacheBy
Atlas Antibodies Anti-ANAPC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANAPC1 Antibody

상품 한눈에 보기

인간 ANAPC1 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 추천됩니다. Rabbit 유래 IgG 형태이며, PrEST 항원으로 정제되었습니다. 인간에 반응하며 rat, mouse와 99% 서열 동일성을 보입니다.

카탈로그번호
HPA042998-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA042998-100 Anti-ANAPC1 Antibody, anaphase promoting complex subunit 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA042998-25 Anti-ANAPC1 Antibody, anaphase promoting complex subunit 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANAPC1 Antibody

Anti-ANAPC1 Antibody

Target: Anaphase Promoting Complex Subunit 1 (ANAPC1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ANAPC1.


Alternative Gene Names

APC1, MCPR, TSG24

Open Datasheet


Target Information

항목 내용
Target Protein Anaphase Promoting Complex Subunit 1
Target Gene ANAPC1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000016965 (99%), Mouse ENSMUSG00000014355 (99%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


Antigen Sequence

PPRNTTVDLNSGNIDVPPNMTSWASFHNGVAAGLKIAPASQIDSAWIVYNKPKHAELANEYAGFLMALGLNGHLTKLATLNIHDYLTKGH

제품 이미지

IHC Recommended Application
WB Recommended Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.