CacheBy
Atlas Antibodies Anti-ANAPC10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ANAPC10 Antibody

상품 한눈에 보기

Human ANAPC10 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human, Mouse, Rat 간 교차 반응성 확인. 안정한 PBS/glycerol buffer에 보존.

카탈로그번호
HPA044547-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA044547-100 Anti-ANAPC10 Antibody, anaphase promoting complex subunit 10 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044547-25 Anti-ANAPC10 Antibody, anaphase promoting complex subunit 10 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ANAPC10 Antibody

Anti-ANAPC10 Antibody

Target: anaphase promoting complex subunit 10 (ANAPC10)
Product Type: Polyclonal Antibody against Human ANAPC10


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody targeting the human ANAPC10 protein, a subunit of the anaphase promoting complex. Designed for detection in IHC and ICC applications.


Alternative Gene Names

APC10, DKFZP564L0562, DOC1

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein anaphase promoting complex subunit 10
Target Gene ANAPC10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence HNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSI
Verified Species Reactivity Human
Interspecies Homology Mouse (ENSMUSG00000036977, 100%), Rat (ENSRNOG00000018296, 100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2) containing 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.