
Atlas Antibodies Anti-AMDHD2 Antibody
상품 한눈에 보기
Human AMDHD2 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 ICC 검증에 적합하며, PrEST 항원을 이용한 친화정제 방식으로 제조됨. 높은 종 간 항원 서열 일치율(93%)을 보유하며, PBS와 glycerol buffer로 안정화되어 있음.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AMDHD2 Antibody
amidohydrolase domain containing 2
Recommended Applications
IHC (Independent Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human AMDHD2
Alternative Gene Names
- CGI-14
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | amidohydrolase domain containing 2 |
| Target Gene | AMDHD2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FITHLFNAMLPFHHRDPGIVGLLTSDRLPAGRCIFYGMIADGTHTNPAALRIAHRAHPQGLVLVTDAIPALGLGNGRHTLGQQEVEVDGLT |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000006460 (93%), Mouse ENSMUSG00000036820 (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-AMER3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AMER2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AMDHD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AMDHD2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-AMDHD1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.