CacheBy
Atlas Antibodies Anti-AMDHD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AMDHD2 Antibody

상품 한눈에 보기

Human AMDHD2 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 및 ICC 검증에 적합하며, PrEST 항원을 이용한 친화정제 방식으로 제조됨. 높은 종 간 항원 서열 일치율(93%)을 보유하며, PBS와 glycerol buffer로 안정화되어 있음.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA041321-100 Anti-AMDHD2 Antibody, amidohydrolase domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041321-25 Anti-AMDHD2 Antibody, amidohydrolase domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AMDHD2 Antibody

Anti-AMDHD2 Antibody

amidohydrolase domain containing 2


  • IHC (Independent Validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • ICC (Immunocytochemistry)


Product Description

Polyclonal Antibody against Human AMDHD2


Alternative Gene Names

  • CGI-14

Open Datasheet


Target Information

항목 내용
Target Protein amidohydrolase domain containing 2
Target Gene AMDHD2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FITHLFNAMLPFHHRDPGIVGLLTSDRLPAGRCIFYGMIADGTHTNPAALRIAHRAHPQGLVLVTDAIPALGLGNGRHTLGQQEVEVDGLT
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000006460 (93%), Mouse ENSMUSG00000036820 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.