CacheBy
Atlas Antibodies Anti-AMER2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AMER2 Antibody

상품 한눈에 보기

Human AMER2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC를 통한 단백질 발현 검증에 적합. Affinity purification 방식으로 정제되었으며, RNA-seq 데이터 기반 Orthogonal validation 제공. 다양한 조직에서의 발현 비교 연구에 유용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA039458-100 Anti-AMER2 Antibody, APC membrane recruitment protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039458-25 Anti-AMER2 Antibody, APC membrane recruitment protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AMER2 Antibody

Anti-AMER2 Antibody

Target: APC membrane recruitment protein 2


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human AMER2.


Alternative Gene Names

FAM123A, FLJ25477

Open Datasheet


Target Information

항목 내용
Target Protein APC membrane recruitment protein 2
Target Gene AMER2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence VDDTYLQEFWDMLSQTEEQGPEPQEGAAKVAAALETKVVPETPKDTRCVEAAKDASSVKRRRLNRIPIEPHPKEEPKHPEKEQQE

Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

종 유전자 ID 항원 서열 유사도
Mouse ENSMUSG00000021986 75%
Rat ENSRNOG00000013623 74%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.