
Atlas Antibodies Anti-ALOX15 Antibody
상품 한눈에 보기
인간 ALOX15 단백질을 인식하는 고품질 폴리클로날 항체입니다. WB 및 IHC에 적합하며, 재조합 단백질 발현 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. 토끼 유래 IgG 포맷으로 안정적 보관이 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ALOX15 Antibody
Target: arachidonate 15-lipoxygenase
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Recombinant Expression)
Recombinant expression validation:
Validated in WB using target protein overexpression.
Product Description
Polyclonal antibody against human ALOX15.
Alternative Gene Names
- 15-LOX-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | arachidonate 15-lipoxygenase |
| Target Gene | ALOX15 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat (66%), Mouse (65%) |
Antigen Sequence:
RTVGEDPQGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAKGLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQ
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ALKBH8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALMS1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALOX15 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKBH5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ALKBH7 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.