CacheBy
Atlas Antibodies Anti-ALKBH8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ALKBH8 Antibody

상품 한눈에 보기

Human ALKBH8 단백질을 인식하는 토끼 폴리클로날 항체로, PrEST 항원을 이용해 친화 정제됨. 면역조직화학(IHC) 등 다양한 연구 응용에 적합하며, 40% 글리세롤 및 PBS 완충액에 보존됨. 인간에 대해 검증된 특이성을 가짐.

카탈로그번호
HPA038724-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038724-100 Anti-ALKBH8 Antibody, alkB, alkylation repair homolog 8 (E. coli) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038724-25 Anti-ALKBH8 Antibody, alkB, alkylation repair homolog 8 (E. coli) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ALKBH8 Antibody

Anti-ALKBH8 Antibody

Target: alkB, alkylation repair homolog 8 (E. coli)

면역조직화학(IHC) 등 다양한 연구용 응용에 적합

Product Description

Polyclonal antibody against Human ALKBH8

Alternative Gene Names

  • MGC10235

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein alkB, alkylation repair homolog 8 (E. coli)
Target Gene ALKBH8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000025899 (78%), Rat ENSRNOG00000024525 (74%)

Antigen Sequence:

TVQASESLKSGIITSDVGDLTLSKRGLRTSFTFRKVRQTPCNCSYPLVCDSQRKETPPSFPESDKEASRLEQEYVHQVYEEIAGHFSSTR

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도와 조건은 사용자가 직접 설정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.