Atlas Antibodies Anti-AKTIP Antibody
상품 옵션 정보 | ||||||
---|---|---|---|---|---|---|
카탈로그 번호 | 설명 | 상태 | 단위 | 가격 | 가격(VAT포함) | 수량 / 장바구니 |
HPA046300-100 | Atlas Antibodies HPA046300-100 Anti-AKTIP Antibody, AKT interacting protein 100ul | 재고문의 | 100ul | 659,000원 | 724,900원 | |
HPA046300-25 | Atlas Antibodies HPA046300-25 Anti-AKTIP Antibody, AKT interacting protein 25ul | 재고문의 | 25ul | 277,000원 | 304,700원 |
다른 상품 둘러보기
Anti-AKTIP Antibody
AKT interacting protein
Recommended Applications
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human AKTIP
Alternative Gene Names
FLJ13258, FTS
Target Protein
AKT interacting protein
Target Gene
AKTIP
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
WFGVIFIRHGLYQDGVFKFTVYIPDNYPDGDCPRLVFDIPVFHPLVDPTSGELDVKRAFAKWRRNHNHIWQVLMYARRVFYKIDTASP
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000011956 (98%)
Mouse ENSMUSG00000031667 (98%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|