CacheBy
Atlas Antibodies Anti-AKT3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AKT3 Antibody

상품 한눈에 보기

인간 AKT3 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제되었습니다. Human에 반응하며, Rat 및 Mouse와 100% 서열 일치합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA026441-100 Anti-AKT3 Antibody, v-akt murine thymoma viral oncogene homolog 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026441-25 Anti-AKT3 Antibody, v-akt murine thymoma viral oncogene homolog 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AKT3 Antibody

Anti-AKT3 Antibody

Target: v-akt murine thymoma viral oncogene homolog 3
Type: Polyclonal Antibody against Human AKT3


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

This is a rabbit polyclonal antibody raised against the human AKT3 protein. It is affinity purified using the PrEST antigen as the affinity ligand.


Alternative Gene Names

PKBG, PRKBG, RAC-gamma

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein v-akt murine thymoma viral oncogene homolog 3
Target Gene AKT3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL

Species Reactivity

항목 내용
Verified Species Reactivity Human
Interspecies Homology Rat ENSRNOG00000021497 (100%), Mouse ENSMUSG00000019699 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.