CacheBy
Atlas Antibodies Anti-AKAP11 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AKAP11 Antibody

상품 한눈에 보기

Human AKAP11 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. 고순도 Affinity 정제 방식으로 제조되었으며, RNA-seq 데이터 기반 단백질 발현 비교 검증에 적합. 다양한 응용 분야에서 신뢰성 높은 결과 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039089-100 Anti-AKAP11 Antibody, A kinase (PRKA) anchor protein 11 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039089-25 Anti-AKAP11 Antibody, A kinase (PRKA) anchor protein 11 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AKAP11 Antibody

Anti-AKAP11 Antibody

A kinase (PRKA) anchor protein 11


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human AKAP11


Alternative Gene Names

AKAP220, DKFZp781I12161, FLJ11304, KIAA0629, PPP1R44, PRKA11

Open Datasheet


Target Information

항목 내용
Target Protein A kinase (PRKA) anchor protein 11
Target Gene AKAP11
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence EHSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFAGDLAAEVITEAEKIAKVRNCM
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000022016 (67%), Rat ENSRNOG00000009987 (64%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.