Atlas Antibodies Anti-AKAP12 Antibody

상품 한눈에 보기

Human AKAP12 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반 Orthogonal 검증 완료. 친화정제 방식으로 높은 특이성과 재현성 제공. HUMAN 시료에 최적화.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA006344-100 Anti-AKAP12 Antibody, A kinase (PRKA) anchor protein 12 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA006344-25 Anti-AKAP12 Antibody, A kinase (PRKA) anchor protein 12 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

A kinase (PRKA) anchor protein 12

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human AKAP12

AKAP250, SSeCKS

항목	내용
Target Protein	A kinase (PRKA) anchor protein 12
Target Gene	AKAP12
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	QRAEAERPEEQAEASGLKKETDVVLKVDAQEAKTEPFTQGKVVGQTTPESFEKAPQVTESIESSELVTTCQAETLAGVKSQEMVMEQAIPPDSVETPTDSETDGST
Verified Species Reactivity	Human
Interspecies Information	Highest antigen sequence identity to the following orthologs: Mouse ENSMUSG00000038587 (45%) Rat ENSRNOG00000019549 (44%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand