Atlas Antibodies Anti-LRTOMT Antibody

상품 한눈에 보기

Human LRTOMT 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Recombinant expression 검증 완료. PrEST 항원으로 친화 정제되었으며, 인체 반응성이 확인되었습니다. 다양한 종에서 높은 서열 유사성을 보입니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039949-100 Anti-LRTOMT Antibody, leucine rich transmembrane and O-methyltransferase domain containing 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039949-25 Anti-LRTOMT Antibody, leucine rich transmembrane and O-methyltransferase domain containing 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-LRTOMT Antibody

Anti-LRTOMT Antibody

leucine rich transmembrane and O-methyltransferase domain containing

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot, Recombinant expression validation)
ICC (Immunocytochemistry)

Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal Antibody against Human LRTOMT

Alternative Gene Names: CFAP111, COMT2, DFNB63, LRRC51
Open Datasheet

Target Information

항목	내용
Target Protein	leucine rich transmembrane and O-methyltransferase domain containing
Target Gene	LRTOMT
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPV

Reactivity and Species Information

항목	내용
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000020124 (87%), Mouse ENSMUSG00000064307 (85%)

Antibody Properties

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand