
Atlas Antibodies Anti-LRTOMT Antibody
상품 한눈에 보기
Human LRTOMT 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Recombinant expression 검증 완료. PrEST 항원으로 친화 정제되었으며, 인체 반응성이 확인되었습니다. 다양한 종에서 높은 서열 유사성을 보입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRTOMT Antibody
leucine rich transmembrane and O-methyltransferase domain containing
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant expression validation)
- ICC (Immunocytochemistry)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human LRTOMT
Alternative Gene Names: CFAP111, COMT2, DFNB63, LRRC51
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich transmembrane and O-methyltransferase domain containing |
| Target Gene | LRTOMT |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MNKRDYMNTSVQEPPLDYSFRSIHVIQDLVNEEPRTGLRPLKRSKSGKSLTQSLWLNNNVLNDLRDFNQVASQLLEHPENLAWIDLSFNDLTSIDPV |
Reactivity and Species Information
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000020124 (87%), Mouse ENSMUSG00000064307 (85%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LSAMP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRWD1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRTOMT Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRSAM1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRTM2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.