CacheBy
Atlas Antibodies Anti-LRSAM1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRSAM1 Antibody

상품 한눈에 보기

Human LRSAM1 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 IHC 응용에 적합합니다. 재조합 발현 검증을 통해 품질이 보증되었으며, PrEST 항원을 이용한 친화 정제 방식으로 제조되었습니다. 인간, 생쥐, 랫트 간 높은 서열 보존성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA021844-100 Anti-LRSAM1 Antibody, leucine rich repeat and sterile alpha motif containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021844-25 Anti-LRSAM1 Antibody, leucine rich repeat and sterile alpha motif containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRSAM1 Antibody

Anti-LRSAM1 Antibody

Target: leucine rich repeat and sterile alpha motif containing 1 (LRSAM1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against human LRSAM1.


Alternative Gene Names

  • FLJ31641

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine rich repeat and sterile alpha motif containing 1
Target Gene LRSAM1
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence LENERIRMEQLMSITQEETESLRRRDVASAMQQMLTESCKNRLIQMAYESQRQNLVQQACSSMAEMDERFQQILSWQQMDQNKAISQI
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000022312 (91%), Mouse ENSMUSG00000026792 (90%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
MSDS Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.