CacheBy
Atlas Antibodies Anti-LRRC75A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC75A Antibody

상품 한눈에 보기

인간 LRRC75A 단백질을 타깃으로 한 폴리클로날 항체. IHC 및 Western blot에 적합하며 재조합 발현 검증 완료. 토끼에서 생산된 IgG 항체로, PrEST 항원 친화 정제. 40% 글리세롤 및 PBS 완충액으로 안정화.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA028528-100 Anti-LRRC75A Antibody, leucine rich repeat containing 75A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028528-25 Anti-LRRC75A Antibody, leucine rich repeat containing 75A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC75A Antibody

Anti-LRRC75A Antibody

Target: leucine rich repeat containing 75A (LRRC75A)
Type: Polyclonal Antibody against Human LRRC75A


  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Recombinant expression validation in WB using target protein overexpression.


Product Description

Polyclonal antibody targeting human LRRC75A protein.


Alternative Gene Names

C17orf76, FAM211A, FLJ35696

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine rich repeat containing 75A
Target Gene LRRC75A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GMVQELLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKP

Species Reactivity

반응성
Human Verified
Mouse 100% (ortholog identity)
Rat 64% (ortholog identity)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.