AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRC75A Antibody
상품 한눈에 보기
인간 LRRC75A 단백질을 타깃으로 한 폴리클로날 항체. IHC 및 Western blot에 적합하며 재조합 발현 검증 완료. 토끼에서 생산된 IgG 항체로, PrEST 항원 친화 정제. 40% 글리세롤 및 PBS 완충액으로 안정화.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA028528-100 Anti-LRRC75A Antibody, leucine rich repeat containing 75A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028528-25 Anti-LRRC75A Antibody, leucine rich repeat containing 75A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRC75A Antibody
Anti-LRRC75A Antibody
Target: leucine rich repeat containing 75A (LRRC75A)
Type: Polyclonal Antibody against Human LRRC75A
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody targeting human LRRC75A protein.
Alternative Gene Names
C17orf76, FAM211A, FLJ35696
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat containing 75A |
| Target Gene | LRRC75A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GMVQELLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKP |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | 100% (ortholog identity) |
| Rat | 64% (ortholog identity) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.