
Atlas Antibodies Anti-LRRC75A Antibody
상품 한눈에 보기
인간 LRRC75A 단백질을 타깃으로 한 폴리클로날 항체. IHC 및 Western blot에 적합하며 재조합 발현 검증 완료. 토끼에서 생산된 IgG 항체로, PrEST 항원 친화 정제. 40% 글리세롤 및 PBS 완충액으로 안정화.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRRC75A Antibody
Target: leucine rich repeat containing 75A (LRRC75A)
Type: Polyclonal Antibody against Human LRRC75A
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal antibody targeting human LRRC75A protein.
Alternative Gene Names
C17orf76, FAM211A, FLJ35696
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat containing 75A |
| Target Gene | LRRC75A |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | GMVQELLRMVRQGRREEAGTLLQHLRQDLGMESTSLDDVLYRYASFRNLVDPITHDLIISLARYIHCPKP |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | 100% (ortholog identity) |
| Rat | 64% (ortholog identity) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LRRC75A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC74B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC75A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC70 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRRC73 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.