
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRRC70 Antibody
상품 한눈에 보기
Human LRRC70 단백질을 인식하는 토끼 다클론 항체로, IHC 등 다양한 연구용 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 고순도의 IgG 형태로 제공됩니다. LOC100130733, SLRN 유전자 대체명으로도 알려져 있습니다.
- 카탈로그번호
- HPA013409-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA013409-100 Anti-LRRC70 Antibody, leucine rich repeat containing 70 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013409-25 Anti-LRRC70 Antibody, leucine rich repeat containing 70 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRRC70 Antibody
Anti-LRRC70 Antibody
Target: leucine rich repeat containing 70 (LRRC70)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human LRRC70 protein.
Alternative Gene Names
- LOC100130733
- SLRN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine rich repeat containing 70 |
| Target Gene | LRRC70 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | PLSSLIHLQANSNPWECNCKLLGLRDWLASSAITLNIYCQNPPSMRGRALRYINITNCVTSSINVSRAWAVVKSPHIHHKTTALMMAWHKVTTNGSPLENTETENITFWERIPTSPAGRFFQENAFGNPLETTAVLPVQIQL |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000042846 | 21% |
| Rat | ENSRNOG00000022428 | 19% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide added as preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



