Atlas Antibodies Anti-AGA Antibody
Human AGA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 단백질 발현을 비교하여 신뢰성 확보. PrEST 항원으로 친화 정제되었으며, Human에 반응. 연구용으로 사용.
- 카탈로그번호
- HPA031417-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Atlas Antibodies · Atlas Antibodies Anti-AGA Antibody
Anti-AGA Antibody
Target Protein: Aspartylglucosaminidase (AGA)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Species Reactivity: Human
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human AGA.
Alternative Gene Names
ASRG
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSV
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000031521 | 86% |
| Rat | ENSRNOG00000000108 | 84% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.