Atlas Antibodies Anti-AGA Antibody
Human AGA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 단백질 발현을 비교하여 신뢰성 확보. PrEST 항원으로 친화 정제되었으며, Human에 반응. 연구용으로 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-AGA Antibody
Target Protein: Aspartylglucosaminidase (AGA)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Species Reactivity: Human
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human AGA.
Alternative Gene Names
ASRG
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSV
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000031521 | 86% |
| Rat | ENSRNOG00000000108 | 84% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|