CacheBy
Atlas Antibodies Anti-AGA Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-AGA Antibody

상품 한눈에 보기

Human AGA 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 단백질 발현을 비교하여 신뢰성 확보. PrEST 항원으로 친화 정제되었으며, Human에 반응. 연구용으로 사용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA031417-100 Anti-AGA Antibody, aspartylglucosaminidase 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031417-25 Anti-AGA Antibody, aspartylglucosaminidase 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-AGA Antibody

Anti-AGA Antibody

Target Protein: Aspartylglucosaminidase (AGA)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Species Reactivity: Human


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human AGA.


Alternative Gene Names

ASRG

Open Datasheet


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
SSPLPLVVNTWPFKNATEAAWRALASGGSALDAVESGCAMCEREQCDGSV


Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000031521 86%
Rat ENSRNOG00000000108 84%

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.