CacheBy
Atlas Antibodies Anti-LRRC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRRC1 Antibody

상품 한눈에 보기

Human LRRC1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 및 Western blot에 적합. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증된 신뢰성 높은 제품. PrEST 항원을 사용한 친화 정제 방식으로 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031604-100 Anti-LRRC1 Antibody, leucine rich repeat containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031604-25 Anti-LRRC1 Antibody, leucine rich repeat containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRRC1 Antibody

Anti-LRRC1 Antibody

Target Protein: leucine rich repeat containing 1 (LRRC1)
Supplier: Atlas Antibodies


  • IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • Western Blot (WB)

Product Description

Polyclonal Antibody against Human LRRC1


Alternative Gene Names

dJ523E19.1, FLJ10775, FLJ11834, LANO

Open Datasheet


Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    NERAVNRVSAIRFVEDEKDEEDNETRTLLRRATPHPGELKHMKKTVENLRNDMNAAKGLDSNKNEVNHAIDRVTT

Verified Species Reactivity

Human, Rat

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000032352 87%
Rat ENSRNOG00000005970 84%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
Western Blot

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.