CacheBy
Atlas Antibodies Anti-LRR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRR1 Antibody

상품 한눈에 보기

Human LRR1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 등 다양한 연구 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. Human에 반응하며 Rat, Mouse와 82% 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA065703-100 Anti-LRR1 Antibody, leucine rich repeat protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA065703-25 Anti-LRR1 Antibody, leucine rich repeat protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRR1 Antibody

Anti-LRR1 Antibody

Target: Leucine Rich Repeat Protein 1 (LRR1)
Supplier: Atlas Antibodies


Product Description

Polyclonal antibody against human LRR1 (leucine rich repeat protein 1).

Alternative Gene Names

LRR-1, MGC20689, PPIL5

Target Information

  • Target Protein: Leucine rich repeat protein 1
  • Target Gene: LRR1
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GSHIIPFHLCQDLDTAKICVCGRFCLNSFIQGTTTMNLHSVAHTVVLVDNLGGTEAPIISYFCSLGCYVNSSDM

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000004216 (82%)
  • Mouse ENSMUSG00000034883 (82%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Recommended Applications Immunohistochemistry (IHC)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Reference Documents


제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.