
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRP2 Antibody
상품 한눈에 보기
Human LRP2 단백질을 인식하는 폴리클로날 항체로, IHC를 통한 단백질 발현 정량에 적합. Rabbit에서 유래한 IgG 항체이며, PrEST 항원을 이용해 친화 정제됨. Human에 특이적으로 반응하며, Orthogonal validation으로 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA064792-100 Anti-LRP2 Antibody, low density lipoprotein receptor-related protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA064792-25 Anti-LRP2 Antibody, low density lipoprotein receptor-related protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRP2 Antibody
Anti-LRP2 Antibody
Target: low density lipoprotein receptor-related protein 2
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human LRP2.
Alternative Gene Names
DBS, gp330
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | low density lipoprotein receptor-related protein 2 |
| Target Gene | LRP2 |
| Verified Species Reactivity | Human |
| Interspecies Information | Highest antigen sequence identity to orthologs: Mouse ENSMUSG00000027070 (78%) Rat ENSRNOG00000056184 (78%) |
Antigen Information
| 항목 | 내용 |
|---|---|
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | GFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQDEEYIQAVDYDWDPEDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKYVMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDL |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide as preservative (Material Safety Data Sheet) |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



