
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LRP1B Antibody
상품 한눈에 보기
Human LRP1B 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 적합. PBS/glycerol buffer에 sodium azide 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA069094-100 Anti-LRP1B Antibody, low density lipoprotein receptor-related protein 1B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069094-25 Anti-LRP1B Antibody, low density lipoprotein receptor-related protein 1B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LRP1B Antibody
Anti-LRP1B Antibody
제품 설명
Polyclonal Antibody against Human LRP1B
Low density lipoprotein receptor-related protein 1B을 타겟으로 하는 항체입니다.
권장 응용 분야
면역조직화학(IHC) 등 다양한 응용에 적합
대체 유전자 이름
LRP-DIT, LRPDIT
타겟 정보
- Target Protein: Low density lipoprotein receptor-related protein 1B
- Target Gene: LRP1B
- Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000049252 | 95% |
| Rat | ENSRNOG00000039050 | 56% |
항체 특성
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
사용 시 주의사항
- 사용 전 부드럽게 혼합하십시오.
- 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



