CacheBy
Atlas Antibodies Anti-LRP1B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRP1B Antibody

상품 한눈에 보기

Human LRP1B 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 적합. PBS/glycerol buffer에 sodium azide 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA069094-100 Anti-LRP1B Antibody, low density lipoprotein receptor-related protein 1B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069094-25 Anti-LRP1B Antibody, low density lipoprotein receptor-related protein 1B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRP1B Antibody

Anti-LRP1B Antibody

제품 설명

Polyclonal Antibody against Human LRP1B
Low density lipoprotein receptor-related protein 1B을 타겟으로 하는 항체입니다.

권장 응용 분야

면역조직화학(IHC) 등 다양한 응용에 적합

대체 유전자 이름

LRP-DIT, LRPDIT

Open Datasheet

타겟 정보

  • Target Protein: Low density lipoprotein receptor-related protein 1B
  • Target Gene: LRP1B
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    GGPSAFKLPHTAPPIYLNSDLKGPLTAGPTNYSNPVYAKLYMDGQNCRNSLGSVDERKELLPKK

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000049252 95%
Rat ENSRNOG00000039050 56%

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

사용 시 주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자에 의해 결정되어야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.