
Atlas Antibodies Anti-LRIG1 Antibody
상품 한눈에 보기
Human LRIG1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등에 적합. siRNA knockdown을 통한 유전적 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. 다양한 종 간 교차 반응 정보 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LRIG1 Antibody
leucine-rich repeats and immunoglobulin-like domains 1
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) — Genetic validation by siRNA knockdown
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human LRIG1.
Alternative Gene Names
DKFZP586O1624, LIG-1, LIG1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine-rich repeats and immunoglobulin-like domains 1 |
| Target Gene | LRIG1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | TRKKSEEYSVTNTDETVVPPDVPSYLSSQGTLSDRQETVVRTEGGPQANGHIESNGVCPRDASHFPEPDTHSVACRQPKLCAGSAYHKEPWKAMEKAEGTPGPHKMEHGGRVVCSDCNTEVDCYS |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000030029 | 74% |
| Rat | ENSRNOG00000012952 | 74% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LRIG3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRIG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRIG1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRGUK Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LRGUK Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.