CacheBy
Atlas Antibodies Anti-LRIG3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LRIG3 Antibody

상품 한눈에 보기

인간 LRIG3 단백질을 인식하는 폴리클로날 항체로 다양한 면역염색(IHC, ICC)에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 토끼 IgG 아이소타입입니다. 인간에 대한 반응성이 검증되었으며, 40% 글리세롤 PBS 버퍼로 안정화되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA010773-100 Anti-LRIG3 Antibody, leucine-rich repeats and immunoglobulin-like domains 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA010773-25 Anti-LRIG3 Antibody, leucine-rich repeats and immunoglobulin-like domains 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LRIG3 Antibody

Anti-LRIG3 Antibody

Target: leucine-rich repeats and immunoglobulin-like domains 3 (LRIG3)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human LRIG3.

Alternative Gene Names

FLJ90440, KIAA3016

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein leucine-rich repeats and immunoglobulin-like domains 3
Target Gene LRIG3
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence NLCLNKSSLDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPN

Verified Species Reactivity

Human

Interspecies Information

유전자 ID 항원 서열 동일성
Mouse ENSMUSG00000020105 69%
Rat ENSRNOG00000007654 68%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.