AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LPP Antibody
상품 한눈에 보기
Human LPP 단백질을 인식하는 고품질 Polyclonal Rabbit IgG 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. Orthogonal 및 Independent validation을 통해 단백질 발현 신뢰도를 검증했습니다. Affinity purification으로 높은 특이성과 재현성을 보장합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA011133-100 Anti-LPP Antibody, LIM domain containing preferred translocation partner in lipoma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011133-25 Anti-LPP Antibody, LIM domain containing preferred translocation partner in lipoma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LPP Antibody
Anti-LPP Antibody
LIM domain containing preferred translocation partner in lipoma (LPP)을 표적하는 Polyclonal Rabbit IgG 항체입니다.
Recommended Applications
- IHC Orthogonal Validation: RNA-seq 데이터와 비교하여 고/저 발현 조직에서 단백질 발현을 교차 검증
(Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.) - WB Independent Validation: 서로 다른 epitope을 인식하는 독립 항체 간 비교를 통한 단백질 발현 검증
(Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.) - ICC: 세포 수준에서 단백질 발현 분석에 적합
Product Description
Polyclonal Antibody against Human LPP
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | LIM domain containing preferred translocation partner in lipoma |
| Target Gene | LPP |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse: 76% (ENSMUSG00000033306), Rat: 67% (ENSRNOG00000031669) |
Antigen Sequence:
PSPHYMAAPSSGQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGYYAAGPGYGGRNDSDPTYGQQGHPNTWKREPGY
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도 및 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.