CacheBy
Atlas Antibodies Anti-LPXN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LPXN Antibody

상품 한눈에 보기

Human LPXN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, 정교한 Orthogonal Validation으로 검증되었습니다. 인간에 특이적으로 반응하며, 안정적인 PBS/glycerol buffer에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043741-100 Anti-LPXN Antibody, leupaxin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043741-25 Anti-LPXN Antibody, leupaxin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LPXN Antibody

Anti-LPXN Antibody

Target Protein: leupaxin
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot) – Orthogonal validation

Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.


Product Description

Polyclonal antibody against Human LPXN.


Alternative Gene Names

  • LDPL

Open Datasheet (PDF)


Antigen Information

Antigen Sequence:
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

AQLVYTTNIQELNVYSEAQEPKESPPPSKTSAAAQLDELMAHLTEMQAKVAVRADAGKKHLPDKQDHKASLDSML

Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000012611 81%
Mouse ENSMUSG00000024696 80%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.