
Atlas Antibodies Anti-ADGRG7 Antibody
상품 한눈에 보기
Human ADGRG7 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. ICC 등 다양한 응용에 적합하며, Affinity purification으로 높은 특이성과 순도를 보장합니다. 40% glycerol과 PBS buffer에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ADGRG7 Antibody
Target Information
- Target Protein: adhesion G protein-coupled receptor G7
- Target Gene: ADGRG7
- Alternative Gene Names: FLJ14454, GPR128
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ADGRG7.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
STSSSSTPTEFCRNGGTWENGRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRLCSLSLYGEIELQKVTIGNCNENLETLEKQVKDVTAPLNNISSEVQILTSDANKLTAEN
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000001634 | 70% |
| Mouse | ENSMUSG00000022755 | 67% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ADGRV1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADGRL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADGRG7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADGRG4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ADGRL3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.