
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-ADGRG7 Antibody
상품 한눈에 보기
Human ADGRG7 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 타입입니다. ICC 등 다양한 응용에 적합하며, Affinity purification으로 높은 특이성과 순도를 보장합니다. 40% glycerol과 PBS buffer에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA056451-100 Anti-ADGRG7 Antibody, adhesion G protein-coupled receptor G7 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056451-25 Anti-ADGRG7 Antibody, adhesion G protein-coupled receptor G7 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-ADGRG7 Antibody
Anti-ADGRG7 Antibody
Target Information
- Target Protein: adhesion G protein-coupled receptor G7
- Target Gene: ADGRG7
- Alternative Gene Names: FLJ14454, GPR128
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human ADGRG7.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
STSSSSTPTEFCRNGGTWENGRCICTEEWKGLRCTIANFCENSTYMGFTFARIPVGRYGPSLQTCGKDTPNAGNPMAVRLCSLSLYGEIELQKVTIGNCNENLETLEKQVKDVTAPLNNISSEVQILTSDANKLTAEN
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000001634 | 70% |
| Mouse | ENSMUSG00000022755 | 67% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



