
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LINC00493 Antibody
상품 한눈에 보기
Human LINC00493 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human 반응성 검증 완료, 연구용으로 적합.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA068733-100 Anti-LINC00493 Antibody, long intergenic non-protein coding RNA 493 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA068733-25 Anti-LINC00493 Antibody, long intergenic non-protein coding RNA 493 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LINC00493 Antibody
Anti-LINC00493 Antibody
Target: long intergenic non-protein coding RNA 493 (LINC00493)
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
OCR 텍스트: Recommended for use in ICC applications.
Product Description
Polyclonal Antibody against Human LINC00493
Alternative Gene Names
- LOC388789
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | long intergenic non-protein coding RNA 493 |
| Target Gene | LINC00493 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000074754 | 38% |
| Rat | ENSRNOG00000036971 | 37% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



