
Atlas Antibodies Anti-LINC00493 Antibody
상품 한눈에 보기
Human LINC00493 인식 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식. Recombinant PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human 반응성 검증 완료, 연구용으로 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LINC00493 Antibody
Target: long intergenic non-protein coding RNA 493 (LINC00493)
Supplier: Atlas Antibodies
Recommended Applications
- ICC (Immunocytochemistry)
OCR 텍스트: Recommended for use in ICC applications.
Product Description
Polyclonal Antibody against Human LINC00493
Alternative Gene Names
- LOC388789
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | long intergenic non-protein coding RNA 493 |
| Target Gene | LINC00493 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SLLYYSRTMAKSSVDQKDGSASEVPSELSERPKGFYVETVVTYKEDFVPNTEKILNYWKSWTGGPGTEP |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000074754 | 38% |
| Rat | ENSRNOG00000036971 | 37% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LINGO2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LINGO1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LINC00493 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LIN7C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LIN7A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.