CacheBy
Atlas Antibodies Anti-LINGO1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LINGO1 Antibody

상품 한눈에 보기

사람 LINGO1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 실험에 적합하며, RNA-seq 데이터 기반의 정교한 직교 검증 수행. PrEST 항원으로 친화 정제된 고품질 항체로 다양한 조직 발현 분석에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074653-100 Anti-LINGO1 Antibody, leucine rich repeat and Ig domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074653-25 Anti-LINGO1 Antibody, leucine rich repeat and Ig domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LINGO1 Antibody

Anti-LINGO1 Antibody

Target: leucine rich repeat and Ig domain containing 1 (LINGO1)
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated by comparison to RNA-seq data in tissues with high and low target expression.
  • ICC

Product Description

Polyclonal antibody against Human LINGO1.


Alternative Gene Names

FLJ14594, LERN1, LRRN6A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein leucine rich repeat and Ig domain containing 1
Target Gene LINGO1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSAV
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000049556 (100%), Rat ENSRNOG00000017193 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.