CacheBy
Atlas Antibodies Anti-LGSN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LGSN Antibody

상품 한눈에 보기

Human LGSN 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 등 단백질 발현 검증에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종 간 보존성을 보입니다. 40% 글리세롤 기반 PBS 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030957-100 Anti-LGSN Antibody, lengsin, lens protein with glutamine synthetase domain 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030957-25 Anti-LGSN Antibody, lengsin, lens protein with glutamine synthetase domain 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LGSN Antibody

Anti-LGSN Antibody

Target: lengsin, lens protein with glutamine synthetase domain
Supplier: Atlas Antibodies


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human LGSN.


Alternative Gene Names

GLULD1, LGS

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein lengsin, lens protein with glutamine synthetase domain
Target Gene LGSN
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI
Verified Species Reactivity Human
Interspecies Identity Rat (89%, ENSRNOG00000012205), Mouse (86%, ENSMUSG00000050217)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.