Atlas Antibodies Anti-LGSN Antibody

상품 한눈에 보기

Human LGSN 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 검증을 통해 신뢰성 확보. PrEST 항원을 이용한 친화정제 방식으로 제조되었으며, 다양한 종 간 교차 반응 정보 제공. 렌즈 단백질 연구 및 단백질 발현 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039983-100 Anti-LGSN Antibody, lengsin, lens protein with glutamine synthetase domain 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039983-25 Anti-LGSN Antibody, lengsin, lens protein with glutamine synthetase domain 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: lengsin, lens protein with glutamine synthetase domain
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human LGSN

GLULD1, LGS

항목	내용
Target Protein	lengsin, lens protein with glutamine synthetase domain
Target Gene	LGSN
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	IISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGI
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000012205 (89%), Mouse ENSMUSG00000050217 (86%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand