
Atlas Antibodies Anti-LGALS7 Antibody
상품 한눈에 보기
Human LGALS7 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB 실험에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성을 제공. Human 반응성이 검증된 고품질 연구용 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LGALS7 Antibody
Target Protein: lectin, galactoside-binding, soluble, 7
Target Gene: LGALS7
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human LGALS7
Alternative Gene Names
GAL7, LGALS7A, PIG1, TP53I1
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSV
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000053522 | 79% |
| Rat | ENSRNOG00000020380 | 74% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LGALS8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.