
Atlas Antibodies Anti-LGALS8 Antibody
Human LGALS8 단백질을 표적으로 하는 폴리클로날 항체로, Rabbit에서 생산됨. ICC 등 다양한 응용 분야에 적합하며, PrEST 항원으로 친화 정제됨. 40% glycerol 기반의 PBS buffer에 보존되어 안정적 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LGALS8 Antibody
Target Protein: lectin, galactoside-binding, soluble, 8
Supplier: Atlas Antibodies
Recommended Applications
면역세포화학(ICC)
Product Description
Polyclonal Antibody against Human LGALS8
Alternative Gene Names
PCTA-1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | lectin, galactoside-binding, soluble, 8 |
| Target Gene | LGALS8 |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000018046 (82%), Mouse ENSMUSG00000057554 (79%) |
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
PLGTVASFQSLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEI
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LGALS14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LGALS1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|