Atlas Antibodies Anti-LGALS4 Antibody

상품 한눈에 보기

Human LGALS4 단백질을 인식하는 Rabbit Polyclonal IgG 항체로, IHC Orthogonal Validation을 통해 검증됨. Recombinant PrEST 항원으로 정제되었으며, 인간에 대한 반응성이 확인됨. GAL4 유전자 타겟 연구에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA031185-100 Anti-LGALS4 Antibody, lectin, galactoside-binding, soluble, 4 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA031185-25 Anti-LGALS4 Antibody, lectin, galactoside-binding, soluble, 4 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-LGALS4 Antibody

Anti-LGALS4 Antibody

Target: lectin, galactoside-binding, soluble, 4
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human LGALS4

Alternative Gene Names: GAL4
Target Protein: lectin, galactoside-binding, soluble, 4
Target Gene: LGALS4

Open Datasheet (PDF)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

PGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSS

Verified Species Reactivity

Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000020338 (72%)
Mouse ENSMUSG00000053964 (69%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen as affinity ligand