AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LDHD Antibody
상품 한눈에 보기
인간 LDHD 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 권장되며 RNA-seq 기반 직교 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA066148-100 Anti-LDHD Antibody, lactate dehydrogenase D 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066148-25 Anti-LDHD Antibody, lactate dehydrogenase D 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LDHD Antibody
Anti-LDHD Antibody
Target Protein: lactate dehydrogenase D (LDHD)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human LDHD.
Validated for use in IHC and WB applications.
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
- Antigen Sequence:
PWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVVWPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQG
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Rat | ENSRNOG00000019036 | 79% |
| Mouse | ENSMUSG00000031958 | 78% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Information
| Component | Description |
|---|---|
| Buffer | PBS (pH 7.2) |
| Additives | 40% glycerol, 0.02% sodium azide (preservative) |
| Safety | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.