CacheBy
Atlas Antibodies Anti-LDHD Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LDHD Antibody

상품 한눈에 보기

인간 LDHD 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에 권장되며 RNA-seq 기반 직교 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성을 제공. PBS/glycerol 버퍼에 보존제로 sodium azide 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066148-100 Anti-LDHD Antibody, lactate dehydrogenase D 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066148-25 Anti-LDHD Antibody, lactate dehydrogenase D 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LDHD Antibody

Anti-LDHD Antibody

Target Protein: lactate dehydrogenase D (LDHD)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Orthogonal validation:
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against human LDHD.
Validated for use in IHC and WB applications.

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
    PWRGYCSQKAKGELCRDFVEALKAVVGGSHVSTAAVVREQHGRDESVHRCEPPDAVVWPQNVEQVSRLAALCYRQGVPIIPFGTGTGLEGGVCAVQG

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000019036 79%
Mouse ENSMUSG00000031958 78%

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Buffer Information

Component Description
Buffer PBS (pH 7.2)
Additives 40% glycerol, 0.02% sodium azide (preservative)
Safety Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.