CacheBy
Atlas Antibodies Anti-LDLRAD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LDLRAD1 Antibody

상품 한눈에 보기

인간 LDLRAD1 단백질을 인식하는 폴리클로날 항체로, 정제된 PrEST 항원 기반 친화 정제 방식 적용. IHC 및 RNA-seq 데이터 비교를 통한 오쏘고날 검증 완료. 사람 반응성 확인, 토끼 유래 IgG 형식. 다양한 조직 단백질 발현 연구에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA052489-100 Anti-LDLRAD1 Antibody, low density lipoprotein receptor class A domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA052489-25 Anti-LDLRAD1 Antibody, low density lipoprotein receptor class A domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LDLRAD1 Antibody

Anti-LDLRAD1 Antibody

Target: Low density lipoprotein receptor class A domain containing 1 (LDLRAD1)
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against human LDLRAD1.
Open Datasheet


Target Information

항목 내용
Target Protein Low density lipoprotein receptor class A domain containing 1
Target Gene LDLRAD1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence GAQACITLTNRTGFLCHDQRSCIPASGVCDGVRTCTHGEDEDESLCRDVPQSLPHFLVAHCGDPASWI
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000070877 (74%), Rat ENSRNOG00000037795 (68%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.