
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-LCMT1 Antibody
상품 한눈에 보기
Human LCMT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat에 반응하며, PrEST 항원을 사용해 제작되었습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA043530-100 Anti-LCMT1 Antibody, leucine carboxyl methyltransferase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043530-25 Anti-LCMT1 Antibody, leucine carboxyl methyltransferase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-LCMT1 Antibody
Anti-LCMT1 Antibody
Target: leucine carboxyl methyltransferase 1 (LCMT1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human LCMT1.
Alternative Gene Names
CGI-68, PPMT1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine carboxyl methyltransferase 1 |
| Target Gene | LCMT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKE |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000030763 (89%)
- Rat ENSRNOG00000014565 (89%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



