
Atlas Antibodies Anti-LCMT1 Antibody
Human LCMT1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. Affinity purification으로 높은 특이성과 재현성을 제공합니다. Human, Mouse, Rat에 반응하며, PrEST 항원을 사용해 제작되었습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-LCMT1 Antibody
Target: leucine carboxyl methyltransferase 1 (LCMT1)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human LCMT1.
Alternative Gene Names
CGI-68, PPMT1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | leucine carboxyl methyltransferase 1 |
| Target Gene | LCMT1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RLLSNGWETASAVDMMELYNRLPRAEVSRIESLEFLDEMELLEQLMRHYCLCWATKGGNELGLKE |
Species Reactivity
- Human
- Mouse
- Rat
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000030763 (89%)
- Rat ENSRNOG00000014565 (89%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-LCMT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LCLAT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LCMT1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LCA5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-LCE6A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|