CacheBy
Atlas Antibodies Anti-LCE6A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-LCE6A Antibody

상품 한눈에 보기

Human LCE6A 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 분석에 적합하며 RNA-seq 데이터 기반 정교한 Orthogonal 검증 완료. 고순도 Affinity 정제 및 안정화 버퍼 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046376-100 Anti-LCE6A Antibody, late cornified envelope 6A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046376-25 Anti-LCE6A Antibody, late cornified envelope 6A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-LCE6A Antibody

Anti-LCE6A Antibody

Target: late cornified envelope 6A (LCE6A)
Type: Polyclonal Antibody against Human LCE6A
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC
    비교 대상: 고/저 발현 조직의 RNA-seq 데이터 기반

Product Description

Polyclonal antibody raised in rabbit against Human LCE6A (late cornified envelope 6A).


Alternative Gene Names

  • C1orf44

Target Information

항목 내용
Target Protein late cornified envelope 6A
Target Gene LCE6A
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MSQQKQQSWKPPNVPKCSPPQRSNPCLAPYSTPCGAPHSEGCHSSSQRPEVQKPRRARQKLRCLSRGTTYHCKEEECEGD
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000055370 (46%), Mouse ENSMUSG00000086848 (45%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.