
원본
Thermo Fisher Scientific ZONAB Polyclonal Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human ZONAB protein for Western blot applications. High predicted reactivity across multiple species. Supplied as unconjugated liquid form at 1 mg/mL. Suitable for research use only, not for diagnostic purposes.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오전 03:10
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA124366 ZONAB Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
782,000원VAT 포함 860,200원
Thermo Fisher Scientific · Thermo Fisher Scientific ZONAB Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 0.2–2.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2229879 |
Product Specific Information
- Recommended positive control: HepG2
- Predicted reactivity: Cow (92%), Dog (92%), Guinea Pig (84%), Mouse (92%), Pig (100%), Rat (100%)
- For Western Blot, use 1 µg/mL in 5% skim milk/PBS buffer
- Store product as a concentrated solution
- Centrifuge briefly prior to opening the vial
Target Information
Human DNA-binding protein (dbpA) is a member of the Y-box binding protein family containing a cold shock domain. Increased expression of Y-box binding proteins in somatic cells is associated with cell proliferation and transformation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지

Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
