Thermo Fisher Scientific ZONAB Polyclonal Antibody
Rabbit polyclonal antibody targeting human ZONAB protein for Western blot applications. High predicted reactivity across multiple species. Supplied as unconjugated liquid form at 1 mg/mL. Suitable for research use only, not for diagnostic purposes.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB)
Tested Dilution: 0.2–2.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | AHVAGNPGGDAAPAATGTAAAASLAAAAGSEDAEKKVLATKVLGTVKWFN |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 1 mg/mL |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2229879 |
Product Specific Information
- Recommended positive control: HepG2
- Predicted reactivity: Cow (92%), Dog (92%), Guinea Pig (84%), Mouse (92%), Pig (100%), Rat (100%)
- For Western Blot, use 1 µg/mL in 5% skim milk/PBS buffer
- Store product as a concentrated solution
- Centrifuge briefly prior to opening the vial
Target Information
Human DNA-binding protein (dbpA) is a member of the Y-box binding protein family containing a cold shock domain. Increased expression of Y-box binding proteins in somatic cells is associated with cell proliferation and transformation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific EAP30 Polyclonal Antibody
740,600원
Thermo Fisher Scientific
Thermo Fisher Scientific TCFL5 Polyclonal Antibody
826,900원
Thermo Fisher Scientific
Thermo Fisher Scientific ZONAB Polyclonal Antibody
782,000원
Thermo Fisher Scientific
Thermo Fisher Scientific IRF9 Polyclonal Antibody
826,900원
Thermo Fisher Scientific
Thermo Fisher Scientific GTF2H3 Polyclonal Antibody
826,900원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|