Thermo Fisher Scientific DDAH2 Polyclonal Antibody
DDAH2 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody. Western blot, IHC, ICC/IF, Flow Cytometry 등 다양한 응용에 사용 가능. 고순도 항원 친화 크로마토그래피 정제 제품으로, 연구용으로만 사용.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific DDAH2 Polyclonal Antibody
Applications and Tested Dilutions
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Immunocytochemistry (ICC/IF) | 2 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Property | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide corresponding to a sequence at the C-terminus of human DDAH2 (190–224aa DAAQKAVRAMAVLTDHPYASLTLPDDAAADCLFLR) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | –20°C |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2746257 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene belongs to the dimethylarginine dimethylaminohydrolase (DDAH) gene family.
The encoded enzyme plays a role in nitric oxide generation by regulating cellular concentrations of methylarginines, which inhibit nitric oxide synthase activity.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific DDB2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific DCK Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific DDAH2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific DDB1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific DCC Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|