
원본
Thermo Fisher Scientific SHROOM2 Polyclonal Antibody
상품 한눈에 보기
인간 SHROOM2 단백질에 특이적인 Rabbit Polyclonal Antibody로, ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제된 액상 형태이며 0.4 mg/mL 농도. 연구용으로만 사용되며, 장기 보관 시 -20°C에서 보관 권장.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 03:06
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA584497 SHROOM2 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
740,000원VAT 포함 814,000원
Thermo Fisher Scientific · Thermo Fisher Scientific SHROOM2 Polyclonal Antibody
Applications
- Immunocytochemistry (ICC/IF)
Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human SHROOM2. Recombinant protein control fragment (Product #RP-108456). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.4 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2791648 |
Product Specific Information
Immunogen sequence:
SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ
Target Information
The protein encoded by this gene shares significant similarities with the apical protein from Xenopus laevis, which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
