
Thermo Fisher Scientific SHROOM2 Polyclonal Antibody
인간 SHROOM2 단백질에 특이적인 Rabbit Polyclonal Antibody로, ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제된 액상 형태이며 0.4 mg/mL 농도. 연구용으로만 사용되며, 장기 보관 시 -20°C에서 보관 권장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Immunocytochemistry (ICC/IF)
Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human SHROOM2. Recombinant protein control fragment (Product #RP-108456). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.4 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2791648 |
Product Specific Information
Immunogen sequence:
SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ
Target Information
The protein encoded by this gene shares significant similarities with the apical protein from Xenopus laevis, which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific TRBP Polyclonal Antibody
740,000원

Thermo Fisher Scientific
Thermo Fisher Scientific C/EBP beta Polyclonal Antibody
740,000원

Thermo Fisher Scientific
Thermo Fisher Scientific SHROOM2 Polyclonal Antibody
740,000원

Thermo Fisher Scientific
Thermo Fisher Scientific PCMTD1 Polyclonal Antibody
740,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Cyclin B1 Polyclonal Antibody
765,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|