원본
Thermo Fisher Scientific SHROOM2 Polyclonal Antibody
상품 한눈에 보기
인간 SHROOM2 단백질에 특이적인 Rabbit Polyclonal Antibody로, ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제된 액상 형태이며 0.4 mg/mL 농도. 연구용으로만 사용되며, 장기 보관 시 -20°C에서 보관 권장.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 03. 오전 03:06
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA584497 SHROOM2 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
740,000원VAT 포함 814,000원
Thermo Fisher Scientific · Thermo Fisher Scientific SHROOM2 Polyclonal Antibody
Applications
- Immunocytochemistry (ICC/IF)
Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human SHROOM2. Recombinant protein control fragment (Product #RP-108456). |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.4 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2791648 |
Product Specific Information
Immunogen sequence:
SPRHHLPQPEGPPDARETGRCYPLDKGAEGCSAGAQEPPRASRAEKASQRLAASITWADGESSRICPQETPLLHSLTQ
Target Information
The protein encoded by this gene shares significant similarities with the apical protein from Xenopus laevis, which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
Thermo Fisher ScientificThermo Fisher Scientific TRBP Polyclonal Antibody740,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific C/EBP beta Polyclonal Antibody740,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific PCMTD1 Polyclonal Antibody740,000원VAT별도
Thermo Fisher ScientificThermo Fisher Scientific Cyclin B1 Polyclonal Antibody765,400원VAT별도
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.