Thermo Fisher Scientific TESPA1 Polyclonal Antibody
TESPA1 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 최적화되어 있음. 인간 시료 반응성이 높으며, 고순도 Affinity Chromatography로 정제됨. PBS 및 sucrose buffer에 보관되며, -20°C에서 안정적 저장 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Thermo Fisher Scientific TESPA1 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the C-terminal of human TESPA1 (aa 394–443) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2610598 |
Product Specific Information
- Peptide sequence: SLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLF
- Sequence homology:
- Dog: 93%
- Horse: 100%
- Human: 100%
- Pig: 100%
- Rabbit: 86%
Target Information
TESPA1 is a critical component of the TCR signalosome and is essential for T cell selection and maturation through regulation of TCR signaling during T cell development. It encodes a protein of 458 amino acids and is highly conserved among vertebrate species. TESPA1 expression is tightly regulated during T cell development, with highest expression at the DP stage. TESPA1 deficiency results in failure of positive selection and substantially fewer CD4+ and CD8+ SP cells in the thymus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific KIAA1683 Polyclonal Antibody
630,500원
Thermo Fisher Scientific
Thermo Fisher Scientific SOGA1 Polyclonal Antibody
630,500원
Thermo Fisher Scientific
Thermo Fisher Scientific TESPA1 Polyclonal Antibody
630,500원
Thermo Fisher Scientific
Thermo Fisher Scientific KBTBD11 Polyclonal Antibody
630,500원
Thermo Fisher Scientific
Thermo Fisher Scientific FRMD1 Polyclonal Antibody
630,500원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|