Thermo Fisher Scientific TESPA1 Polyclonal Antibody
TESPA1 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot에 최적화되어 있음. 인간 시료 반응성이 높으며, 고순도 Affinity Chromatography로 정제됨. PBS 및 sucrose buffer에 보관되며, -20°C에서 안정적 저장 가능.
- 카탈로그번호
- PA546497
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific TESPA1 Polyclonal Antibody
Thermo Fisher Scientific TESPA1 Polyclonal Antibody
Applications
- Western Blot (WB)
Tested Dilution: 1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Synthetic peptide directed towards the C-terminal of human TESPA1 (aa 394–443) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Affinity Chromatography |
| Storage Buffer | PBS with 2% sucrose |
| Contains | 0.09% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
| RRID | AB_2610598 |
Product Specific Information
- Peptide sequence: SLPIEDPQWSTDPAQIRRELCSLPATNTETHPAKDETFWKRKSRARKSLF
- Sequence homology:
- Dog: 93%
- Horse: 100%
- Human: 100%
- Pig: 100%
- Rabbit: 86%
Target Information
TESPA1 is a critical component of the TCR signalosome and is essential for T cell selection and maturation through regulation of TCR signaling during T cell development. It encodes a protein of 458 amino acids and is highly conserved among vertebrate species. TESPA1 expression is tightly regulated during T cell development, with highest expression at the DP stage. TESPA1 deficiency results in failure of positive selection and substantially fewer CD4+ and CD8+ SP cells in the thymus.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.